SKU: 29215330615

Human PIGF, His tag

Sale price$159.75 Regular price$177.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PIGF, His tagProduct Specification Species Human Synonyms PLGF Accession P49763 2 Amino Acid Sequence Protein sequence (P49763 2, Leu19 Arg149, with C 10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 4kDa Actual: 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Human
Synonyms PLGF
Accession P49763-2
Amino Acid Sequence

Protein sequence (P49763-2, Leu19-Arg149, with C-10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 16.4kDa Actual: 30kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

Placental growth factor (PIGF) is a member of the VEGF (vascular endothelial growth factor) sub-family - a key molecule in angiogenesis and vasculogenesis, in particular during embryogenesis. The main source of PIGF during pregnancy is the placental trophoblast. PIGF is also expressed in many other tissues, including the villous trophoblast. Placental growth factor-expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth. Serum levels of PIGF and sFlt-1 (soluble fms-like tyrosine kinase-1, also known as soluble VEGF receptor-1) are altered in women with preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29215330615

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 881 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Deborah P.
Cuba, US
★★★★★ 2
Disappointing
Color: Natural, Size: 4 Panels, Color: Natural, Size: 4 Panels
I hoped to return this room divider but learned too late it doesn't have free returns. I bought this and another one that didn't have the solid wood on the bottom and had smaller rectangular wooden lattice. The other one looks great. On this one, the backing paper material was very sloppily glued on and has a wrinkled appearance on all four panels. The other screen I purchased was glued properly and the paper is nice and flat and neat looking. I do like the basic design of this, but am pretty disappointed because it looks sloppy and cheap because of the paper. The paper looks yellow in my photo because of lighting, it is white.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025
C
Verified Purchase
Chris Stockbridge
Cuba, US
★★★★★ 5
Worth the investment
Size: 1 Panel, Size: 1 Panel
I had to order this in an emergency. To put it in brief words, I live in a two level studio unit. My bedroom TV fell backwards off the bureau accidentally and down the stairs to its demise. Putting this together was no problem, instructions were thorough and easy. It came with several bars that connected together smoothly and an Allen key for the brackets and screws for the feet. I did one less horizontal bar on top and bottom so it could fit, which was great because with all of them on it was too long. However I ran into the difficulty of the horizontal bars popping out of the brackets during the last stages, but eventually got it done. I was also looking for a specific type of divider where I could adjust the feet so I could tuck it in between the dresser and banister. Glad I made this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
I
Verified Purchase
Interloper
Draper, US
★★★★★ 1
You Get What You Pay For! A Piece Of Junk!
Size: 1 Panel
Flimsy and a piece of junk. Don’t waste your money. Assembly is a pain because it is so flimsy. Divider is thin. You can see right through it. Very wobbly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
J
Verified Purchase
JAMES HAYES
Charlottesville, US
★★★★★ 4
Instructions are useless
Size: 1 Panel
The instructions are poorly written and not very helpful. The divider itself is easy to assemble, and honestly, it would’ve been quicker if I had skipped the directions altogether. Once put together, though, it works as intended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
P
Platinum Motif
Waukegan, US
★★★★★ 5
This was the best
Size: 1 Panel
This divider is great for creating a little privacy or separating a small area without taking up much space. The fabric is thick enough to block visual clutter, and the frame is lightweight but stable once it’s opened. It folds flat for storage, which is convenient if you only need it occasionally. Assembly was straightforward, and it was the perfect size. It’s a practical piece for apartments, studios, or home offices where you want a quick, temporary partition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026

recommand products