SKU: 78025368036

Mouse NK1.1/CD161, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse NK1.1/CD161, His tagProduct Specification Species Mouse Synonyms Killer cell lectin like receptor subfamily B member 1C, CD161 antigen like family member C, Lymphocyte antigen 55c (Ly 55c), NKR P1. 9, NKR P1C, Natural killer cell surface protein P1 40 (NKR P1 40), Klrb1c Accession P27814 Amino Acid Sequence Protein sequence(P27814, Gln67 Ser223, with C 10*His)

Product Specification


Species Mouse
Synonyms Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c (Ly-55c), NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40 (NKR-P1 40), Klrb1c
Accession P27814
Amino Acid Sequence

Protein sequence(P27814, Gln67-Ser223, with C-10*His) QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:19.6kDa Actual:28kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD161 is one of the earliest markers expressed during NK cell maturation from CD34+ hematopoietic stem cell precursors. Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion. CD161 is expressed early in NK cell development, where it may facilitate cross-talk of NK cell precursors with cells within the bone marrow, and is involved in CXCL8 release. Within the periphery, cross-linking of CD161 leads to an increase in IFNγ expression and inhibition of NK cell cytotoxicity. There have been various reports of modulated expression of CD161 on NK cells during viral infections. For instance, reduced CD161 expression in acute hepatitis C virus (HCV) infection predicted viral clearance, and correlated with increased liver inflammation in chronic HCV infection. Patients with chronic human immunodeficiency virus (HIV) infection have depleted CD161+ NK cells compared to healthy donors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78025368036

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 917 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Ms. Mullen
Draper, US
★★★★★ 5
Best acne spot patches!
The best ace patches! I first bought them on a trip to Japan, and was using them sparingly until I ran out. They came fast and are about the same price as in Japan. Would absolutely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2025
B
Verified Purchase
Brooklyn
Dallas, US
★★★★★ 5
Dogs favorite toy
Color: Orange & Blue Roller, Size: 7.5 inches (1 Pack), Color: Orange & Blue Roller, Size: 7.5 inches (1 Pack)
I buy 4 of these every month for my dog. He won’t go anywhere without this ball. He sleeps with it, swims with it, goes to the vet and carries it around in his mouth to show off. It’s borderline a problem. My dog is a large breed and plays hard so I do purchase often because the strings unravel and the ball itself is foam so breaks down into little pieces after a few days of playing. I love that it is fragile on his teeth and jaw. We can play catch indoors because it is soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
A
Verified Purchase
Amanda L.
Port Orchard, US
★★★★★ 5
Love it!!!
Color: Orange & Blue Fetch Ball, Size: 4.75 inches (1 Pack)
Great for indoor fetch! Definitely hit the windows and the TV a couple times without any worry. Super fun, my dog loves it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
H
Verified Purchase
Heather E.
Battle Creek, US
★★★★★ 5
Worth the purchase
Color: Orange & Blue Fumbler, Size: 3 x 8.5 x 9 inches (1 Pack)
Perfect for indoor use. My aggressive chewer loves this and has not destroyed it yet after 6 months. I recommend for indoor use as it causes NO damage or noise.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
M
Verified Purchase
Megan
Cuba, US
★★★★★ 4
My lab loves t
Color: Orange & Blue Fumbler, Size: 3 x 8.5 x 9 inches (1 Pack)
This toy is my labs favorite toy. She’s obsessed and we were happy to find a toy she loves that can stay inside with us. The problem is how easily she tears it apart. We have to buy her a new one every month because when she bites into it it breaks down the foam inside, and from there she shreds the roping it’s covered in. We try to stop her, but with how often we play with it it’s inevitable. We have resigned ourselves to buying a new one once a month.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026

recommand products