SKU: 69414171573

Human C1q , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human C1q , His tagProduct Specification Species Human Synonyms Complement C1q subcomponent subunit A Accession P02745 Amino Acid Sequence Protein sequence(P02745, Glu23 Arg150, with C 10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 7kDa Actual: 20 25kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag

Product Specification


Species Human
Synonyms Complement C1q subcomponent subunit A
Accession P02745
Amino Acid Sequence Protein sequence(P02745, Glu23-Arg150, with C-10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:14.7kDa Actual:20-25kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The complement component 1q (or simply C1q) is a protein complex involved in the complement system, which is part of the innate immune system. Antibodies of the adaptive immune system can bind antigen, forming an antigen-antibody complex. When C1q binds antigen-antibody complexes, the C1 complex becomes activated. Activation of the C1 complex initiates the classical complement pathway of the complement system. By virtue of its ability to bind to IgG and IgM containing immune complexes and activating the classical pathway, C1q acts as prototypical link between innate and adaptive immune wings of the immune system. The notion of C1q involvement in the pathogenesis of cancer is still evolving. C1q appears to have a dual role in cancer: tumor promoting as well as tumor-protective, depending on the context of the disease.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69414171573

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1642 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
mariahmay11
Alexandria, US
★★★★★ 5
It’s worth it, surprisingly
Size: Full, Style: 18 Inch ( Foldable)
Legitimately surprised at the size and quality. I got the full size 18” height and was worried it’d be wobbly and creaky, but it’s surprisingly stable. And for $100 in this economy? Worth. There’s no noise at all, and it’s solid. Took less than 2 minutes to assemble, truly a couple clicks and 2 hand screws. The full came in 2 pieces so the compact size together is about the size of a suitcase and very flat, we could almost take this camping it’s so handy. I don’t often write reviews but I was shocked. (This is a real human)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
S
Verified Purchase
S Val
Belleville, US
★★★★★ 5
Highly recommend
Size: Queen, Style: 14 Inch ( Foldable)
This is a great bed frame. We have bought 3 now. It is super easy to set up. Unfold and screw two large bolts to connect the two sides. No tools needed. We first bought one for grown our son to go with the 10 inch foam mattress. We thought it would be easier to manage if he were to move. Then we bought one for our foam mattress when the box springs was wearing out. Amazing ! It fit perfectly in inside our queen size bed frame with a headboard and footboard. Love it. We also bought one as stand alone frame for the guestbed foam mattress. We're happy campers! These are strong, inexpensive and much easier to move than a platform bed or box springs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
R
Verified Purchase
Rachel Devon
Dallas, US
★★★★★ 5
Gorgeous bed 10/10
This bed is awesome. Sturdy, beautiful, and unique. The headboard and color and quality of wood is truly stunning, especially for the price. Super sturdy slats that screw into place and make the base very solid. I am using it with no box spring and it is working great. I would buy it again in a heartbeat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
S
Verified Purchase
Sy
Draper, US
★★★★★ 2
Not long lasting
Size: Full, Size: Full
Very pretty bed and it seemed sturdy at first, but unfortunately it didn’t even last a month. I use the bed regularly with normal everyday use no heavy activity or excessive weight and the middle support beams still gave out completely. It might work well as a guest bed that isn’t used often, but I wouldn’t recommend it for daily use. The frame actually gave out while I was simply sitting on the corner of the bed. And before anyone assumes otherwise, I’m not a large person. I rarely leave reviews, but this experience was disappointing enough that I felt I needed to warn others.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 5
Perfect
Size: Twin
Excellent quality, and beautiful!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products