SKU: 77673789900

Human IL-8 , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8 , His tagProduct Specification Species Human Synonyms C X C motif chemokine 8, Chemokine (C X C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP 1), Monocyte derived neutrophil chemotactic factor (MDNCF), CXCL8 Accession P10145 Amino Acid Sequence Protein sequence(P10145, Ser28 Ser99, with C 10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 10.

Product Specification


Species Human
Synonyms C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), Monocyte-derived neutrophil chemotactic factor (MDNCF), CXCL8
Accession P10145
Amino Acid Sequence

Protein sequence(P10145, Ser28-Ser99, with C-10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:10.1kDa Actual:10kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 8 (IL-8 or chemokine (C-X-C motif) ligand 8, CXCL8) is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells. Endothelial cells store IL-8 in their storage vesicles, the Weibel-Palade bodies. IL-8 is initially produced as a precursor peptide of 99 amino acids which then undergoes cleavage to create several active IL-8 isoforms. In culture, a 72 amino acid peptide is the major form secreted by macrophages. Interleukin-8 is a key mediator associated with inflammation where it plays a key role in neutrophil recruitment and neutrophil degranulation. IL-8 has also been implied to have a role in colorectal cancer by acting as an autocrine growth factor for colon carcinoma cell lines or the promotion of division and possible migration by cleaving metalloproteinase molecules. It has also been shown that IL-8 plays an important role in chemoresistance of malignant pleural mesothelioma by inducing expression of transmembrane transporters.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77673789900

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1693 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
giedz
New York, US
★★★★★ 4
works great except on windows
Size: 32 Fl Oz (Pack of 1), Style: Fresh
I bought this to clean everything (dash, door trim and jambs, custom floor mats, infotainment system, center console, windows) but my leather seats and it cleans well and dries quickly without leaving behind that sticky and unnatural shine which is what I prefer. if you like everything having that “wet” look, this isn’t the product for you. my one complaint is that it absolutely does not leave a steak free finish on windows which is fine as I should probably own stock in Sprayway at this point. I was just hoping to carry one less cleaning product but this eliminated 2 so I count that as a win.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
B
Verified Purchase
Benjamin
Chelsea, US
★★★★★ 5
Chemical Guys Total Interior Cleaner & Protectant 16oz
Size: 16 Fl Oz (Pack of 1), Style: Fresh
A True All-in-One Interior Cleaner That Delivers The Chemical Guys Total Interior Cleaner & Protectant has quickly become one of my favorite detailing products. If you’re like me and want one product that can handle multiple surfaces inside your car, this is about as close to perfect as it gets. It’s versatile, effective, and safe to use on just about everything, which makes it a huge time-saver compared to juggling several specialized cleaners. What stands out most is the versatility. I’ve used this on my dashboard, touchscreen, center console, door panels, leather seats, steering wheel, and even glass with excellent results. It wipes away dust, light dirt, fingerprints, and smudges with ease, and it doesn’t leave behind streaks or any sticky residue. The finish is clean and natural—there’s no over-the-top greasy shine, just a subtle, refreshed look that makes the whole interior feel new again. Another highlight is the built-in UV protection. Living in a sunny area, I’ve seen dashboards and plastics fade or crack over time. Knowing this cleaner has UV blockers gives me peace of mind that I’m not just cleaning but also protecting the surfaces from long-term damage. That’s a major plus that many other interior cleaners don’t provide in one step. The scent is another nice touch. It has a fresh, light smell that makes the car feel clean without being overpowering or artificial. Some cleaners leave behind strong chemical odors, but this one is subtle enough that it doesn’t clash with air fresheners or linger too heavily after use. Application is simple. Spray it directly on the surface or onto a microfiber cloth, wipe, and you’re done. It doesn’t streak screens or glass, which honestly surprised me the first time I used it—I expected at least some hazing, but it left my infotainment screen spotless. It’s also gentle enough that I don’t worry about damaging sensitive areas like electronics or leather. In terms of performance, I can’t really find any negatives. For deep stains or heavily neglected interiors, you might need more specialized products, but as a general maintenance cleaner, this is exactly what I want. It keeps the whole car interior looking clean and well-maintained without having to carry around a shelf full of different sprays. Overall, the Chemical Guys Total Interior Cleaner & Protectant is a must-have for anyone serious about keeping their car in great condition. It’s versatile, easy to use, smells pleasant, and adds UV protection on top of cleaning power. I’d recommend it to anyone—from casual car owners who just want a quick wipe-down solution to enthusiasts who detail regularly. For me, this is a solid 5-star product—an all-in-one solution that lives up to its promise and makes interior detailing faster and easier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 9, 2025
J
Verified Purchase
jacqueline
Fort Morgan, US
★★★★★ 5
Worth it.
Size: 16 Fl Oz (Pack of 1), Style: Fresh
Love this products. Regret not getting this sooner or even the kit. But super good, and actually smells pretty good no harsh chemical smell. Removed any stained I had with such easy. Which made application easy, just spray on microfiber towel and wipe away. A little expensive but again my fault for not going with the kit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
D
Verified Purchase
Dennis
Whiting, US
★★★★★ 5
Consumer
Size: 16 Fl Oz (Pack of 1), Style: Fresh
It’s just a great cleaner no residue you don’t need a lot of it. No weird or funky stink to it. It just cleans.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
Y
Verified Purchase
ym
Los Angeles, US
★★★★★ 3
Not effective as a cleaner
Size: 16 Fl Oz (Pack of 1), Style: Fresh
If you’re looking for a cleaner, this ain’t it. It’s about as effective as water on plastic.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products