SKU: 49834488302

Human CD16b, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD16b, His tagProduct Specification Species Human Synonyms Low affinity immunoglobulin gamma Fc region receptor III B, Fc gamma RIII beta, FcR 10, IgG Fc receptor III 1, FCGR3B, FCG3, FCGR3, IGFR3 Accession O75015 Amino Acid Sequence Protein sequence(O75015, Gly17 Ser200, with C 10*His)

Product Specification


Species Human
Synonyms Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCGR3B, FCG3, FCGR3, IGFR3
Accession O75015
Amino Acid Sequence Protein sequence(O75015, Gly17-Ser200, with C-10*His) GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:22.5kDa Actual:35-50kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD16, also known as FcγRIII, is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, macrophages, and certain T cells. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). It can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49834488302

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 1536 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Hannah
Bozeman, US
★★★★★ 5
Best Sunscreen Ever
Size: 6 Ounce (Pack of 1), Style: Spray, Size: 6 Ounce (Pack of 1), Style: Spray
BEST. SUNSCREEN. EVER. Seriously. My skin is paper-white and I'm highly tattooed, so sun safety is very important to me. 100 SPF for total protection is unbeatable and I have yet to burn even a little. I'm also very texture-sensitive so I can't stand thick, gloopy, sticky lotions. This one actually sprays on clear, soaks in right away, is light, and even a little bit refreshing. The spray mechanism also makes it easier to get my back without help. There's no off-putting smell, no mess, no problems. I do reapply if I'm out for a while so I'll need to reorder soon, but I'm not mad about it at all. It's very affordable compared to the alternatives and entirely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 7, 2023
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 4
Still fried.
Size: 6 Ounce (Pack of 1), Style: Spray
Smells good and you don’t feel it after applying it. My son and I still got sun burnt which is normal for our fair skin. I’ve never blistered before and using this I did even reapplying half way through my time of being on the beach for an hour and most of that time under an umbrella.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
K
Verified Purchase
Ken
Draper, US
★★★★★ 5
My first choice for Spray SPF 100 rated products.
Size: 6 Ounce (Pack of 1), Style: Spray
I really like this spray on SPF 100 product over other brands I have used. There is really no issues with application and no detectable odor or fragrance after it drys. I really can't find anything negative to note about this stuff & it seems to work well. For someone who needs the very best sunblock to use every day, this wins my First Place Award over all the other products I have used.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2025
S
Verified Purchase
Sarah
New York, US
★★★★★ 5
Great kid stuff
Size: 6 Ounce (Pack of 1), Style: Spray
This stuff is great and works well for kids and adults alike. Used at the zoo this past week and on my young kid almost every day. Yes, really, but does really well. I have not had any burns or irritation with this product. Spray, rub and go. Easy to carry and a lot of product in each can.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2025
D
Verified Purchase
Diamond
Birmingham, US
★★★★★ 5
Works great feels great
Size: 6 Ounce (Pack of 1), Style: Spray
Definitely worth the money I still bought 2 of these bottles, but I found it locally cheaper in stores so I would check them out first but I do still highly recommend because of how good it works!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026

recommand products