SKU: 15423015031

ASFV p54, His tag

$40.50 $45.00
Save 10%
No.2 Bestseller on chemicals-recycling.com >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ASFV p54, His tagProduct Specification Species African Swine Fever Synonyms pE183L Accession Q65194 Amino Acid Sequence Protein sequence(Q65194 Ser54 Leu183, with C 10*His) SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 15. 5kDa Actual: 20kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species African Swine Fever
Synonyms pE183L
Accession Q65194
Amino Acid Sequence

Protein sequence(Q65194 Ser54-Leu183, with C-10*His)
SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH
Expression System E.coli
Molecular Weight Theoretical:15.5kDa Actual: 20kDa
Purity

>95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

African swine fever (ASF) is a highly lethal hemorrhagic viral disease of swine that usually results to a mortality rate approaching 100% in domestic pigs and is classified as a notifiable disease by the World Organization for Animal Health (OIE). A number of studies have reported that p54 is one of the most important ASFV proteins and plays a key role in virus morphogenesis and viral infection. Anti-p54 sera were found to inhibit ASFV attachment to susceptible cells, suggesting its role in virus entry. Similarly, p54/E183L gene plays an essential role in virus viability and recruitment of envelop precursors to assembly sites. Most importantly, E183L gene is crucial for virus particle transporting to perinuclear factory via direct binding to light chain 8 (LC8) of the dynein. A short p54 peptide (149–161 aa) near to its C-terminus is enough to bind to dynein light chain 8 (DLC8) and act as a cargo transport for virus particle.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15423015031

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1510 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Angela Rose
Houston, US
★★★★★ 5
Great value.
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
Excellent value for the money. They are not the most thick or soft. But they are better than some. It’s a good middle of the road towel. A very durable paper towel for various odd and end cleanups.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
K
Verified Purchase
Kortney
Lowell, US
★★★★★ 5
House staple
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
These Sparkle Pick-A-Size Paper Towels are a great everyday household staple. I really like the pick-a-size option because it helps reduce waste when you only need a small sheet for quick cleanups. The towels are absorbent, durable, and strong enough for kitchen messes, spills, counters, and general household cleaning without falling apart easily. They also tear cleanly and fit standard paper towel holders well. The rolls lasted longer than expected thanks to the smaller sheet option. Overall, a dependable and budget-friendly paper towel choice to keep stocked at home.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Michael Lucas
Omaha, US
★★★★★ 4
Decent Quality, Will Buy Again
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
I recently picked up the Sparkle Pick-A-Size Paper Towels (6 pack) and overall I’m pretty happy with them. The pick-a-size feature is really convenient because you can tear off a smaller sheet for quick spills instead of wasting a full one. For everyday kitchen messes—wiping counters, small spills, or drying hands—they work perfectly well. They’re also reasonably absorbent and the rolls seem to last a decent amount of time, especially when using the smaller sheet sizes. For the price, it feels like a good value compared to some of the more expensive brands. The reason I’m giving 4 stars instead of 5 is that they’re not quite as thick or strong as the premium paper towels out there. For bigger or really messy cleanups, I sometimes end up using two sheets. Overall though, these are a solid everyday paper towel that get the job done and help reduce waste with the pick-a-size option. I’d definitely buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
R
Verified Purchase
Roberta
Belleville, US
★★★★★ 5
Really impressed with the quality and absorption
Package Size Name: Double, Size: 12 Double Rolls (Pack of 1), Package Size Name: Double, Size: 12 Double Rolls (Pack of 1)
I’ve been using these Sparkle paper towels for a few days now, mostly in my kitchen, and I’m honestly impressed. The absorption is great, it handles spills like coffee or oil without needing a bunch of sheets. I also love the “tear-a-square” feature because you can use just what you need and avoid waste. They’re pretty strong too, don’t fall apart easily while cleaning, which makes a big difference for tougher messes. So far, totally worth it and I would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
A
Verified Purchase
Amy Biggs
Carnegie, US
★★★★★ 5
Lifesaver for a Single mom With Kids and Constant Messes
Package Size Name: Double, Size: 24 Double Rolls (Pack of 1), Package Size Name: Double, Size: 24 Double Rolls (Pack of 1)
What I Expected: I honestly expected these to be just another basic paper towel that looked good in the listing but ran out fast, fell apart, or left a lot of lint the second my kids spilled something. The listing made them seem thick, strong, and a good value for a busy household. What I Got: After using them for a few weeks, I can say they have been a literal lifesaver. Between two kids, muddy shoes, spilled juice in the truck, quick cleanups in the garage, and wiping down the RV before a trip, these have held up way better than I expected. I’ve noticed minimal shrinkage after wet use, and they rarely leave any lint behind, which is a huge plus for cleaning everything from countertops to tools. What I Like: The pick-a-size sheets are great because I do not waste a full sheet for a small mess, and the towels are strong enough that I usually only need one. They are soft enough for everyday kitchen use but still durable when cleaning greasy tools or bigger messes. Quick tip for buyers: keep an extra roll in the truck or RV because they come in handy more than you think. What I Don’t Like: The only downside is that the rolls are large and take up a little more storage space. Final Verdict: Great for families, busy parents, garages, trucks, or RVs. Minimal shrinkage, low lint, and super durable—I will definitely buy these again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026

recommand products

Winshill Contemporary 2 Door Floor Standing Vanity Unit with Minimalist Basin, Grey, 800mm
200.00
1/8 Ctw Curvy Chevron Leaf Motif Round Cut Diamond Fashion Band in 10K Yellow Gold
315.00
7/8 Ctw Princess Shape Oval and Round Cut Diamond Semi-Mount Engagement Ring in 14K Rose and White Gold
2370.00
16X6 MM Hexagon Shape Amethyst and 1/10 Ctw Round Cut Diamond Semi-Precious Ring in 10K Yellow Gold
695.00
1/5 Ctw Serpent Round Cut Diamond Open Fashion Ring in 10K Yellow Gold
445.00