SKU: 17791292810

Human VEGF 121, His tag

$166.50 $185.00
Save 10%
No.2 Bestseller on chemicals-recycling.com >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 121, His tagProduct Specification Species Human Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 15. 7kDa Actual: 16kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH
Expression System CHO
Molecular Weight

Theoretical:15.7kDa Actual:16kDa
Purity

＞90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF-121) is a naturally-occurring VEGF-A splice variant involved in embryonic vasculogenesis and angiogenesis. VEGF binds to VEGFR-1 and VEGFR-2, and activates Raf/MEK/ERK and PI3K/AKT pathways. VEGF-121 is released as a freely diffusible protein by a variety of normal and transformed cells. It plays an important role in neurogenesis both in vitro and in vivo. It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. VEGF also promotes growth and survival of vascular endothelial cells, monocyte chemotaxis, and colony formation by granulocyte-macrophage progenitor cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17791292810

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1902 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Angela Rose
Lexington, US
★★★★★ 5
Great value.
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
Excellent value for the money. They are not the most thick or soft. But they are better than some. It’s a good middle of the road towel. A very durable paper towel for various odd and end cleanups.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
K
Verified Purchase
Kortney
Port Orchard, US
★★★★★ 5
House staple
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
These Sparkle Pick-A-Size Paper Towels are a great everyday household staple. I really like the pick-a-size option because it helps reduce waste when you only need a small sheet for quick cleanups. The towels are absorbent, durable, and strong enough for kitchen messes, spills, counters, and general household cleaning without falling apart easily. They also tear cleanly and fit standard paper towel holders well. The rolls lasted longer than expected thanks to the smaller sheet option. Overall, a dependable and budget-friendly paper towel choice to keep stocked at home.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Michael Lucas
Cuba, US
★★★★★ 4
Decent Quality, Will Buy Again
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
I recently picked up the Sparkle Pick-A-Size Paper Towels (6 pack) and overall I’m pretty happy with them. The pick-a-size feature is really convenient because you can tear off a smaller sheet for quick spills instead of wasting a full one. For everyday kitchen messes—wiping counters, small spills, or drying hands—they work perfectly well. They’re also reasonably absorbent and the rolls seem to last a decent amount of time, especially when using the smaller sheet sizes. For the price, it feels like a good value compared to some of the more expensive brands. The reason I’m giving 4 stars instead of 5 is that they’re not quite as thick or strong as the premium paper towels out there. For bigger or really messy cleanups, I sometimes end up using two sheets. Overall though, these are a solid everyday paper towel that get the job done and help reduce waste with the pick-a-size option. I’d definitely buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
R
Verified Purchase
Roberta
New York, US
★★★★★ 5
Really impressed with the quality and absorption
Package Size Name: Double, Size: 12 Double Rolls (Pack of 1), Package Size Name: Double, Size: 12 Double Rolls (Pack of 1)
I’ve been using these Sparkle paper towels for a few days now, mostly in my kitchen, and I’m honestly impressed. The absorption is great, it handles spills like coffee or oil without needing a bunch of sheets. I also love the “tear-a-square” feature because you can use just what you need and avoid waste. They’re pretty strong too, don’t fall apart easily while cleaning, which makes a big difference for tougher messes. So far, totally worth it and I would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
A
Verified Purchase
Amy Biggs
Boise, US
★★★★★ 5
Lifesaver for a Single mom With Kids and Constant Messes
Package Size Name: Double, Size: 24 Double Rolls (Pack of 1), Package Size Name: Double, Size: 24 Double Rolls (Pack of 1)
What I Expected: I honestly expected these to be just another basic paper towel that looked good in the listing but ran out fast, fell apart, or left a lot of lint the second my kids spilled something. The listing made them seem thick, strong, and a good value for a busy household. What I Got: After using them for a few weeks, I can say they have been a literal lifesaver. Between two kids, muddy shoes, spilled juice in the truck, quick cleanups in the garage, and wiping down the RV before a trip, these have held up way better than I expected. I’ve noticed minimal shrinkage after wet use, and they rarely leave any lint behind, which is a huge plus for cleaning everything from countertops to tools. What I Like: The pick-a-size sheets are great because I do not waste a full sheet for a small mess, and the towels are strong enough that I usually only need one. They are soft enough for everyday kitchen use but still durable when cleaning greasy tools or bigger messes. Quick tip for buyers: keep an extra roll in the truck or RV because they come in handy more than you think. What I Don’t Like: The only downside is that the rolls are large and take up a little more storage space. Final Verdict: Great for families, busy parents, garages, trucks, or RVs. Minimal shrinkage, low lint, and super durable—I will definitely buy these again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026

recommand products

1 Ctw Emerald Shape 5 Stone Emerald & Round Cut Diamond Halo Wedding Band in 14K Yellow Gold
2140.00
16X6 MM Pear Shape Citrine and 1/6 Ctw Round Cut Diamond Semi-Precious Ring in 10K Yellow Gold
675.00
1 1/10 Ctw Graduated Bezel Set Round Cut Diamond Fashion Hoop Earrings in 14K Yellow Gold
2215.00
1/2 Ctw Round Cut Diamond Open Window Oval Link Bangle in 14K Yellow Gold
3990.00
1/4 Ctw Octagon and Round Cut Diamond Fashion Halo Pendant With Chain in 14K Yellow Gold
690.00